PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604802.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 319aa    MW: 36443.7 Da    PI: 4.667
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604802.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-1996149356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t++q++ Le+ Fe ++++  e++ +LAk+lgL+ rq+ +WFqNrRa+++
  XP_009604802.1  96 KKRRLTADQVQFLEKSFEVENKLEPERKDQLAKELGLQPRQIVIWFQNRRARWR 149
                     56789************************************************9 PP

2HD-ZIP_I/II126.11.6e-4095186192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl+++qv++LE+sFe e+kLeperK +la+eLglqprq+ +WFqnrRAR++tkqlEkdyeaL+++yd+lk++  +L ke+++Lr+++ 
  XP_009604802.1  95 EKKRRLTADQVQFLEKSFEVENKLEPERKDQLAKELGLQPRQIVIWFQNRRARWRTKQLEKDYEALRNKYDNLKADYINLLKEKDDLRAQVI 186
                     69**************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.65391151IPR001356Homeobox domain
SMARTSM003891.5E-1994155IPR001356Homeobox domain
SuperFamilySSF466891.88E-1994162IPR009057Homeodomain-like
PfamPF000461.5E-1696149IPR001356Homeobox domain
CDDcd000866.83E-1896152No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2097158IPR009057Homeodomain-like
PRINTSPR000311.4E-5122131IPR000047Helix-turn-helix motif
PRINTSPR000311.4E-5131147IPR000047Helix-turn-helix motif
PfamPF021836.1E-13151192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MAGRGLFYGD AAGFNGTLLQ KQRLMSSSSS SFATKEAVGS LLVPGYSPSF LASGSMFSFR  60
GVNGGNKSDR SFFQSFDQVE ENETDDLEEY LHQPEKKRRL TADQVQFLEK SFEVENKLEP  120
ERKDQLAKEL GLQPRQIVIW FQNRRARWRT KQLEKDYEAL RNKYDNLKAD YINLLKEKDD  180
LRAQVIQFTD KLLLKEKEKG ELATCDIKEL SPKENMIDPV LEDEMSKVSA ITLKQHKDLN  240
SVKSDVFDSE SLVQSSILDQ GDSSYAFEPD QSDLSQDEEE NLSKNLVAKV VHDHYPMTSS  300
NLSCFGYLVE DQGFGFWSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604802.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X1
TrEMBLM1CDJ81e-124M1CDJ8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000652071e-123(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-42homeobox 1